PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E00688.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 269aa    MW: 29814.6 Da    PI: 9.2357
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E00688.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.78.6e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++ rqvtf+kRrng+lKKA+ELS+LCdae+a++ifss+g+lyeyss
  Pahal.E00688.2  9 KRIENTTSRQVTFCKRRNGLLKKAYELSILCDAEIALVIFSSRGRLYEYSS 59
                    79***********************************************96 PP

2K-box106.92.4e-35801748100
           K-box   8 s..leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                     +  ++ + +++ qqe+akL ++i++Lq+++Rhl+Ge++++++ keL+++e++Le+++ +iRskK+elll+ ie++qk+e elq+en+ Lr+k++e
  Pahal.E00688.2  80 ApvVDVNSHQYFQQEAAKLHQQIQTLQNSNRHLMGESIGNMTAKELKSIESRLERGIGRIRSKKHELLLADIEYMQKREAELQSENMFLRAKVAE 174
                     445778899***********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.571161IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.00E-45275No hitNo description
SuperFamilySSF554552.35E-32274IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-32323IPR002100Transcription factor, MADS-box
PfamPF003197.8E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-323859IPR002100Transcription factor, MADS-box
PfamPF014867.0E-2885172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.86188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSILCD AEIALVIFSS RGRLYEYSSN  60
SVRSTIERYK KASASTSGTA PVVDVNSHQY FQQEAAKLHQ QIQTLQNSNR HLMGESIGNM  120
TAKELKSIES RLERGIGRIR SKKHELLLAD IEYMQKREAE LQSENMFLRA KVAEAERAQQ  180
EAAEDQQMAP PPDVAEATTE LQALPASLDP RGYYLQAQAS MMAAASAAAA SSSSQHQQGQ  240
QEHHHLQTAL HLGYHIKVDS AAASKGFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-21173173Myocyte-specific enhancer factor 2B
1tqe_R7e-21173173Myocyte-specific enhancer factor 2B
1tqe_Q7e-21173173Myocyte-specific enhancer factor 2B
1tqe_P7e-21173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970830.11e-170PREDICTED: MADS-box transcription factor 21
RefseqXP_004970831.11e-170PREDICTED: MADS-box transcription factor 21
SwissprotQ8RU311e-132MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLK3XKX81e-170K3XKX8_SETIT; Uncharacterized protein
STRINGSi002551m1e-169(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.11e-88MIKC_MADS family protein